SCOPe 2.05: Domain d1l7qa1: 1l7q A:352-574

Lineage for d1l7qa1 (1l7q A:352-574)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins)

6. Protein Bacterial cocaine esterase, C-terminal domain [69223] (1 species)

7. Species Rhodococcus sp. mb1 [TaxId:51612] [69224] (4 PDB entries)

8. Domain d1l7qa1: 1l7q A:352-574 [77791]
   Other proteins in same PDB: d1l7qa2
   complexed with bez; mutant

Details for d1l7qa1

PDB Entry: 1l7q, 1.76 Å

PDB Description: ser117ala mutant of bacterial cocaine esterase coce

PDB Compounds: (A:) cocaine esterase

SCOPe Domain Sequences for d1l7qa1:

Sequence; same for both SEQRES and ATOM records:

>d1l7qa1 b.18.1.13 (A:352-574) Bacterial cocaine esterase, C-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]}
plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng
dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg
raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk
ydrnsntggviareqleemctavnrihrgpehpshivlpiikr

Timeline for d1l7qa1:

• d1l7qa1 first appeared in SCOP 1.63
  
• d1l7qa1 appears in SCOPe 2.04
  
• d1l7qa1 appears in SCOPe 2.06
  
• d1l7qa1 appears in the current release, SCOPe 2.08