SCOP 1.75: Domain d1l7ec2: 1l7e C:801-943,C:1127-1179

Lineage for d1l7ec2 (1l7e C:801-943,C:1127-1179)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
   L-alanine dehydrogenase homologue

7. Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)

8. Domain d1l7ec2: 1l7e C:801-943,C:1127-1179 [77787]
   Other proteins in same PDB: d1l7ea1, d1l7eb1, d1l7ec1, d1l7ed1

Details for d1l7ec2

PDB Entry: 1l7e, 1.9 Å

PDB Description: Crystal Structure of R. rubrum Transhydrogenase Domain I with Bound NADH

PDB Compounds: (C:) nicotinamide nucleotide Transhydrogenase, subunit alpha 1

SCOP Domain Sequences for d1l7ec2:

Sequence; same for both SEQRES and ATOM records:

>d1l7ec2 c.23.12.2 (C:801-943,C:1127-1179) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpal

Timeline for d1l7ec2:

• d1l7ec2 first appeared in SCOP 1.63
  
• d1l7ec2 appears in SCOP 1.73
  
• d1l7ec2 appears in SCOPe 2.01
  
• d1l7ec2 appears in the current release, SCOPe 2.08