SCOP 1.65: Domain d1l7ec1: 1l7e C:944-1126

Lineage for d1l7ec1 (1l7e C:944-1126)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
   L-alanine dehydrogenase homologue

7. Species Rhodospirillum rubrum [TaxId:1085] [63938] (4 PDB entries)

8. Domain d1l7ec1: 1l7e C:944-1126 [77786]
   Other proteins in same PDB: d1l7ea2, d1l7eb2, d1l7ec2, d1l7ed2

Details for d1l7ec1

PDB Entry: 1l7e, 1.9 Å

PDB Description: Crystal Structure of R. rubrum Transhydrogenase Domain I with Bound NADH

SCOP Domain Sequences for d1l7ec1:

Sequence, based on SEQRES records:

>d1l7ec1 c.2.1.4 (C:944-1126) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Sequence, based on observed residues (ATOM records):

>d1l7ec1 c.2.1.4 (C:944-1126) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfikqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsv
iidlaveaggncplsepgkivvkhgvkivghtnvpsr

Timeline for d1l7ec1:

• d1l7ec1 first appeared in SCOP 1.63
  
• d1l7ec1 appears in SCOP 1.67
  
• d1l7ec1 appears in the current release, SCOPe 2.08