Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) |
Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins) |
Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species) L-alanine dehydrogenase homologue |
Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries) |
Domain d1l7ea2: 1l7e A:1-143,A:327-378 [77783] Other proteins in same PDB: d1l7ea1, d1l7eb1, d1l7ec1, d1l7ed1 complexed with nai |
PDB Entry: 1l7e (more details), 1.9 Å
SCOPe Domain Sequences for d1l7ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l7ea2 c.23.12.2 (A:1-143,A:327-378) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet vsgtcvtrdgaivhpa
Timeline for d1l7ea2: