Lineage for d1l7dc1 (1l7d C:944-1126)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 238994Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 239023Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
    L-alanine dehydrogenase homologue
  7. 239024Species Rhodospirillum rubrum [TaxId:1085] [63938] (4 PDB entries)
  8. 239027Domain d1l7dc1: 1l7d C:944-1126 [77778]
    Other proteins in same PDB: d1l7da2, d1l7db2, d1l7dc2, d1l7dd2

Details for d1l7dc1

PDB Entry: 1l7d (more details), 1.81 Å

PDB Description: Crystal Structure of R. rubrum Transhydrogenase Domain I without Bound NAD(H)

SCOP Domain Sequences for d1l7dc1:

Sequence, based on SEQRES records: (download)

>d1l7dc1 c.2.1.4 (C:944-1126) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Sequence, based on observed residues (ATOM records): (download)

>d1l7dc1 c.2.1.4 (C:944-1126) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkp
gsviidlaveaggncplsepgkivvkhgvkivghtnvpsr

SCOP Domain Coordinates for d1l7dc1:

Click to download the PDB-style file with coordinates for d1l7dc1.
(The format of our PDB-style files is described here.)

Timeline for d1l7dc1: