SCOP 1.73: Domain d1l7db1: 1l7d B:544-726

Lineage for d1l7db1 (1l7d B:544-726)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
   L-alanine dehydrogenase homologue

7. Species Rhodospirillum rubrum [TaxId:1085] [63938] (15 PDB entries)

8. Domain d1l7db1: 1l7d B:544-726 [77776]
   Other proteins in same PDB: d1l7da2, d1l7db2, d1l7dc2, d1l7dd2

Details for d1l7db1

PDB Entry: 1l7d, 1.81 Å

PDB Description: Crystal Structure of R. rubrum Transhydrogenase Domain I without Bound NAD(H)

PDB Compounds: (B:) nicotinamide nucleotide Transhydrogenase, subunit alpha 1

SCOP Domain Sequences for d1l7db1:

Sequence, based on SEQRES records:

>d1l7db1 c.2.1.4 (B:544-726) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Sequence, based on observed residues (ATOM records):

>d1l7db1 c.2.1.4 (B:544-726) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgs
viidlaveaggncplsepgkivvkhgvkivghtnvpsr

Timeline for d1l7db1:

• d1l7db1 first appeared in SCOP 1.63
  
• d1l7db1 appears in SCOP 1.71
  
• d1l7db1 appears in SCOP 1.75
  
• d1l7db1 appears in the current release, SCOPe 2.08