SCOPe 2.06: Domain d1l7da2: 1l7d A:1-143,A:327-377

Lineage for d1l7da2 (1l7d A:1-143,A:327-377)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)

6. Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
   L-alanine dehydrogenase homologue

7. Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)

8. Domain d1l7da2: 1l7d A:1-143,A:327-377 [77775]
   Other proteins in same PDB: d1l7da1, d1l7db1, d1l7dc1, d1l7dd1

Details for d1l7da2

PDB Entry: 1l7d, 1.81 Å

PDB Description: Crystal Structure of R. rubrum Transhydrogenase Domain I without Bound NAD(H)

PDB Compounds: (A:) nicotinamide nucleotide Transhydrogenase, subunit alpha 1

SCOPe Domain Sequences for d1l7da2:

Sequence; same for both SEQRES and ATOM records:

>d1l7da2 c.23.12.2 (A:1-143,A:327-377) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhp

Timeline for d1l7da2:

• d1l7da2 first appeared in SCOP 1.63
  
• d1l7da2 appears in SCOPe 2.05
  
• d1l7da2 appears in SCOPe 2.07
  
• d1l7da2 appears in the current release, SCOPe 2.08