SCOPe 2.08: Domain d1l7ab_: 1l7a B:

Lineage for d1l7ab_ (1l7a B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
   Pfam PF05448; AXE1

6. Protein Cephalosporin C deacetylase [82505] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [82506] (3 PDB entries)

8. Domain d1l7ab_: 1l7a B: [77773]
   structural genomics
   CASP5

Details for d1l7ab_

PDB Entry: 1l7a, 1.5 Å

PDB Description: structural genomics, crystal structure of cephalosporin c deacetylase

PDB Compounds: (B:) Cephalosporin C deacetylase

SCOPe Domain Sequences for d1l7ab_:

Sequence; same for both SEQRES and ATOM records:

>d1l7ab_ c.69.1.25 (B:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}
mqlfdlpldqlqtykpektapkdfsefwklsleelakvqaepdlqpvdypadgvkvyrlt
yksfgnaritgwyavpdkegphpaivkyhgynasydgeihemvnwalhgyatfgmlvrgq
qrsedtsisphghalgwmtkgildkdtyyyrgvyldavralevissfdevdetrigvtgg
sqgggltiaaaalsdipkaavadypylsnferaidvaleqpyleinsffrrngspetevq
amktlsyfdimnladrvkvpvlmsiglidkvtppstvfaaynhletkkelkvyryfghey
ipafqteklaffkqilkg

Timeline for d1l7ab_:

• d1l7ab_ first appeared in SCOP 1.63
  
• d1l7ab_ appears in SCOPe 2.07