Lineage for d1l7aa_ (1l7a A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1617344Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
    Pfam PF05448; AXE1
  6. 1617359Protein Cephalosporin C deacetylase [82505] (1 species)
  7. 1617360Species Bacillus subtilis [TaxId:1423] [82506] (3 PDB entries)
  8. 1617361Domain d1l7aa_: 1l7a A: [77772]
    structural genomics
    CASP5

Details for d1l7aa_

PDB Entry: 1l7a (more details), 1.5 Å

PDB Description: structural genomics, crystal structure of cephalosporin c deacetylase
PDB Compounds: (A:) Cephalosporin C deacetylase

SCOPe Domain Sequences for d1l7aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}
mqlfdlpldqlqtykpektapkdfsefwklsleelakvqaepdlqpvdypadgvkvyrlt
yksfgnaritgwyavpdkegphpaivkyhgynasydgeihemvnwalhgyatfgmlvrgq
qrsedtsisphghalgwmtkgildkdtyyyrgvyldavralevissfdevdetrigvtgg
sqgggltiaaaalsdipkaavadypylsnferaidvaleqpyleinsffrrngspetevq
amktlsyfdimnladrvkvpvlmsiglidkvtppstvfaaynhletkkelkvyryfghey
ipafqteklaffkqilkg

SCOPe Domain Coordinates for d1l7aa_:

Click to download the PDB-style file with coordinates for d1l7aa_.
(The format of our PDB-style files is described here.)

Timeline for d1l7aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1l7ab_