Lineage for d1l7aa_ (1l7a A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 248565Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 248566Superfamily c.69.1: alpha/beta-Hydrolases [53474] (26 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 249044Family c.69.1.25: Acetyl esterase (deacetylase) [82504] (1 protein)
  6. 249045Protein Cephalosporin C deacetylase [82505] (1 species)
  7. 249046Species Bacillus subtilis [TaxId:1423] [82506] (1 PDB entry)
  8. 249047Domain d1l7aa_: 1l7a A: [77772]

Details for d1l7aa_

PDB Entry: 1l7a (more details), 1.5 Å

PDB Description: structural genomics, crystal structure of cephalosporin c deacetylase

SCOP Domain Sequences for d1l7aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis}
mqlfdlpldqlqtykpektapkdfsefwklsleelakvqaepdlqpvdypadgvkvyrlt
yksfgnaritgwyavpdkegphpaivkyhgynasydgeihemvnwalhgyatfgmlvrgq
qrsedtsisphghalgwmtkgildkdtyyyrgvyldavralevissfdevdetrigvtgg
sqgggltiaaaalsdipkaavadypylsnferaidvaleqpyleinsffrrngspetevq
amktlsyfdimnladrvkvpvlmsiglidkvtppstvfaaynhletkkelkvyryfghey
ipafqteklaffkqilkg

SCOP Domain Coordinates for d1l7aa_:

Click to download the PDB-style file with coordinates for d1l7aa_.
(The format of our PDB-style files is described here.)

Timeline for d1l7aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1l7ab_