Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain [81942] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [81943] (1 PDB entry) |
Domain d1l6za1: 1l6z A:1-107 [77770] Other proteins in same PDB: d1l6za2 complexed with nag, ndg |
PDB Entry: 1l6z (more details), 3.32 Å
SCOPe Domain Sequences for d1l6za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} evtieavppqvaednnvlllvhnlplalgafawykgnttaidkeiarfvpnsnmnftgqa ysgreiiysngsllfqmitmkdmgvytldmtdenyrrtqatvrfhvh
Timeline for d1l6za1: