SCOPe 2.03: Domain d1l6za1: 1l6z A:1-107

Lineage for d1l6za1 (1l6z A:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain [81942] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [81943] (1 PDB entry)

8. Domain d1l6za1: 1l6z A:1-107 [77770]
   Other proteins in same PDB: d1l6za2
   complexed with nag, ndg

Details for d1l6za1

PDB Entry: 1l6z, 3.32 Å

PDB Description: crystal structure of murine ceacam1a[1,4]: a coronavirus receptor and cell adhesion molecule in the cea family

PDB Compounds: (A:) biliary glycoprotein C

SCOPe Domain Sequences for d1l6za1:

Sequence; same for both SEQRES and ATOM records:

>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
evtieavppqvaednnvlllvhnlplalgafawykgnttaidkeiarfvpnsnmnftgqa
ysgreiiysngsllfqmitmkdmgvytldmtdenyrrtqatvrfhvh

Timeline for d1l6za1:

• d1l6za1 first appeared in SCOP 1.63
  
• d1l6za1 appears in SCOPe 2.02
  
• d1l6za1 appears in SCOPe 2.04
  
• d1l6za1 appears in the current release, SCOPe 2.08