Lineage for d1l6rb_ (1l6r B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322675Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 322676Superfamily c.108.1: HAD-like [56784] (10 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 322774Family c.108.1.10: Predicted hydrolases Cof [82388] (2 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 322775Protein Hypothetical protein TA0175 [82389] (1 species)
  7. 322776Species Archaeon Thermoplasma acidophilum [TaxId:2303] [82390] (2 PDB entries)
  8. 322778Domain d1l6rb_: 1l6r B: [77769]
    complexed with ca, fmt

Details for d1l6rb_

PDB Entry: 1l6r (more details), 1.4 Å

PDB Description: crystal structure of thermoplasma acidophilum 0175 (apc0014)

SCOP Domain Sequences for d1l6rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6rb_ c.108.1.10 (B:) Hypothetical protein TA0175 {Archaeon Thermoplasma acidophilum}
hmirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflgin
gpvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdidpe
dvdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnndm
pmfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm

SCOP Domain Coordinates for d1l6rb_:

Click to download the PDB-style file with coordinates for d1l6rb_.
(The format of our PDB-style files is described here.)

Timeline for d1l6rb_: