![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (10 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.10: Predicted hydrolases Cof [82388] (1 protein) contains an alpha+beta subdomain inserted into a new site after strand 3 |
![]() | Protein Hypothetical protein TA0175 [82389] (1 species) |
![]() | Species Archaeon Thermoplasma acidophilum [TaxId:2303] [82390] (2 PDB entries) |
![]() | Domain d1l6rb_: 1l6r B: [77769] structural genomics protein; complexed with ca, fmt |
PDB Entry: 1l6r (more details), 1.4 Å
SCOP Domain Sequences for d1l6rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6rb_ c.108.1.10 (B:) Hypothetical protein TA0175 {Archaeon Thermoplasma acidophilum} hmirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflgin gpvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdidpe dvdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnndm pmfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm
Timeline for d1l6rb_: