Lineage for d1l6ra_ (1l6r A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1187611Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1187612Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1187856Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 1187872Protein Phosphoglycolate phosphatase, PGPase [82389] (2 species)
  7. 1187876Species Thermoplasma acidophilum [TaxId:2303] [82390] (2 PDB entries)
  8. 1187877Domain d1l6ra_: 1l6r A: [77768]
    structural genomics
    complexed with ca, fmt

Details for d1l6ra_

PDB Entry: 1l6r (more details), 1.4 Å

PDB Description: crystal structure of thermoplasma acidophilum 0175 (apc0014)
PDB Compounds: (A:) hypothetical protein TA0175

SCOPe Domain Sequences for d1l6ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Thermoplasma acidophilum [TaxId: 2303]}
hmirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflgin
gpvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdidpe
dvdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnndm
pmfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm

SCOPe Domain Coordinates for d1l6ra_:

Click to download the PDB-style file with coordinates for d1l6ra_.
(The format of our PDB-style files is described here.)

Timeline for d1l6ra_: