Lineage for d1l6ra_ (1l6r A:)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (10 families) 
usually contains an insertion (sub)domain after strand 1Family c.108.1.10: Predicted hydrolases Cof [82388] (1 protein)
contains an alpha+beta subdomain inserted into a new site after strand 3Protein Hypothetical protein TA0175 [82389] (1 species) Species Archaeon Thermoplasma acidophilum [TaxId:2303] [82390] (2 PDB entries) 
Domain d1l6ra_: 1l6r A: [77768]
Details for d1l6ra_
PDB Entry: 1l6r (more details), 1.4 Å
PDB Description: crystal structure of thermoplasma acidophilum 0175 (apc0014)
SCOP Domain Sequences for d1l6ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6ra_ c.108.1.10 (A:) Hypothetical protein TA0175 {Archaeon Thermoplasma acidophilum}
hmirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflgin
gpvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdidpe
dvdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnndm
pmfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm
SCOP Domain Coordinates for d1l6ra_:
Click to download the PDB-style file with coordinates for d1l6ra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l6ra_:
- d1l6ra_ is new in SCOP 1.63
- d1l6ra_ appears in SCOP 1.65
- d1l6ra_ appears in the current release, SCOPe 2.08, called d1l6ra1
View in 3D
