Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.6: Apolipoprotein A-II [82935] (1 superfamily) segmented tetrameric parallel coiled coil |
Superfamily h.6.1: Apolipoprotein A-II [82936] (1 family) |
Family h.6.1.1: Apolipoprotein A-II [82937] (1 protein) |
Protein Apolipoprotein A-II [82938] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82939] (3 PDB entries) |
Domain d1l6ls_: 1l6l S: [77760] a lipid surrogate complex complexed with bog |
PDB Entry: 1l6l (more details), 2.3 Å
SCOPe Domain Sequences for d1l6ls_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6ls_ h.6.1.1 (S:) Apolipoprotein A-II {Human (Homo sapiens) [TaxId: 9606]} epcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnf lsyfvelgtqpatq
Timeline for d1l6ls_:
View in 3D Domains from other chains: (mouse over for more information) d1l6l1_, d1l6l2_, d1l6l3_, d1l6l4_, d1l6l5_, d1l6l6_, d1l6l7_, d1l6l8_, d1l6la_, d1l6lb_, d1l6lc_, d1l6ld_, d1l6le_, d1l6lf_, d1l6lg_, d1l6lh_, d1l6li_, d1l6lj_, d1l6lk_, d1l6ll_, d1l6lm_, d1l6ln_, d1l6lp_, d1l6lq_, d1l6lt_, d1l6lu_, d1l6lv_, d1l6lw_, d1l6lx_, d1l6ly_, d1l6lz_ |