Lineage for d1l6ha_ (1l6h A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 214325Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 214326Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (3 families) (S)
    can be classified as disulphide-rich
  5. 214327Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (3 proteins)
  6. 214328Protein Non-specific lipid-transfer protein homologue (ns-LTP2) [81787] (1 species)
    different pattern for Cys-pairing compared with ns-LTP1
  7. 214329Species Rice (Oryza sativa) [TaxId:4530] [81788] (1 PDB entry)
  8. 214330Domain d1l6ha_: 1l6h A: [77723]

Details for d1l6ha_

PDB Entry: 1l6h (more details)

PDB Description: Solution Structure of Plant nsLTP2 purified from Rice (oryza Sativa)

SCOP Domain Sequences for d1l6ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l6ha_ a.52.1.1 (A:) Non-specific lipid-transfer protein homologue (ns-LTP2) {Rice (Oryza sativa)}
agcnagqltvctgaiaggarptaaccsslraqqgcfcqfakdprygryvnspnarkavss
cgialptch

SCOP Domain Coordinates for d1l6ha_:

Click to download the PDB-style file with coordinates for d1l6ha_.
(The format of our PDB-style files is described here.)

Timeline for d1l6ha_: