Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.106: SurE-like [64166] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7 |
Superfamily c.106.1: SurE-like [64167] (2 families) some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family |
Family c.106.1.1: SurE-like [64168] (2 proteins) |
Protein SurE homolog PAE2908 (SurE-alpha) [82522] (1 species) |
Species Pyrobaculum aerophilum [TaxId:13773] [82523] (1 PDB entry) |
Domain d1l5xb1: 1l5x B:1-267 [77719] Other proteins in same PDB: d1l5xa2, d1l5xb2 complexed with acy, gol |
PDB Entry: 1l5x (more details), 2 Å
SCOPe Domain Sequences for d1l5xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l5xb1 c.106.1.1 (B:1-267) SurE homolog PAE2908 (SurE-alpha) {Pyrobaculum aerophilum [TaxId: 13773]} mkilvtnddgvhspglrllyqfalslgdvdvvapespksatglgitlhkplrmyevdlcg fraiatsgtpsdtvylatfglgrkydivlsginlgdntslqvilssgtlgaafqaallgi palaysaylenwnellnnkeaveimgavvsstasyvlkngmpqgvdvisvnfprrlgrgv raklvkaaklryaqqvvervdprgvryywlygrdlapepetdvyvvlkeggiaitpltln lnavdahrevdmdslnrmveyinasls
Timeline for d1l5xb1: