Lineage for d1l5xb1 (1l5x B:1-267)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919320Fold c.106: SurE-like [64166] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7
  4. 2919321Superfamily c.106.1: SurE-like [64167] (2 families) (S)
    some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
  5. 2919322Family c.106.1.1: SurE-like [64168] (2 proteins)
  6. 2919323Protein SurE homolog PAE2908 (SurE-alpha) [82522] (1 species)
  7. 2919324Species Pyrobaculum aerophilum [TaxId:13773] [82523] (1 PDB entry)
  8. 2919326Domain d1l5xb1: 1l5x B:1-267 [77719]
    Other proteins in same PDB: d1l5xa2, d1l5xb2
    complexed with acy, gol

Details for d1l5xb1

PDB Entry: 1l5x (more details), 2 Å

PDB Description: The 2.0-Angstrom resolution crystal structure of a survival protein E (SurE) homolog from Pyrobaculum aerophilum
PDB Compounds: (B:) Survival protein E

SCOPe Domain Sequences for d1l5xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5xb1 c.106.1.1 (B:1-267) SurE homolog PAE2908 (SurE-alpha) {Pyrobaculum aerophilum [TaxId: 13773]}
mkilvtnddgvhspglrllyqfalslgdvdvvapespksatglgitlhkplrmyevdlcg
fraiatsgtpsdtvylatfglgrkydivlsginlgdntslqvilssgtlgaafqaallgi
palaysaylenwnellnnkeaveimgavvsstasyvlkngmpqgvdvisvnfprrlgrgv
raklvkaaklryaqqvvervdprgvryywlygrdlapepetdvyvvlkeggiaitpltln
lnavdahrevdmdslnrmveyinasls

SCOPe Domain Coordinates for d1l5xb1:

Click to download the PDB-style file with coordinates for d1l5xb1.
(The format of our PDB-style files is described here.)

Timeline for d1l5xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1l5xb2