Lineage for d1l5qb_ (1l5q B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 321275Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 321276Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (7 families) (S)
  5. 321310Family c.87.1.4: Oligosaccharide phosphorylase [53766] (2 proteins)
  6. 321311Protein Glycogen phosphorylase [53767] (3 species)
    both domains are elaborated with many insertions
  7. 321315Species Human (Homo sapiens) [TaxId:9606] [53768] (8 PDB entries)
  8. 321319Domain d1l5qb_: 1l5q B: [77713]
    complexed with 700, cff, nbg, plp

Details for d1l5qb_

PDB Entry: 1l5q (more details), 2.25 Å

PDB Description: human liver glycogen phosphorylase a complexed with caffeine, n- acetyl-beta-d-glucopyranosylamine, and cp-403700

SCOP Domain Sequences for d1l5qb_:

Sequence, based on SEQRES records: (download)

>d1l5qb_ c.87.1.4 (B:) Glycogen phosphorylase {Human (Homo sapiens)}
nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfnlrdfnvgdy
iqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrga
gtvfdafpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpe
alerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinma
hlcivgshavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglael
iaekigedyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssm
fdvqvkriheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiikl
itsvadvvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfm
lngaltigtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvi
dqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvl
kniaasgkfssdrtikeyaqniwnveps

Sequence, based on observed residues (ATOM records): (download)

>d1l5qb_ c.87.1.4 (B:) Glycogen phosphorylase {Human (Homo sapiens)}
nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndyiqavldrnla
enisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfvfdafpdqvaiqlndt
hpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprhl
eiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakihs
divktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqltk
lhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqllnc
lhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgskl
kviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvema
eeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfkd
iinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikey
aqniwnveps

SCOP Domain Coordinates for d1l5qb_:

Click to download the PDB-style file with coordinates for d1l5qb_.
(The format of our PDB-style files is described here.)

Timeline for d1l5qb_: