Lineage for d1l5ka_ (1l5k A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 990677Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567
  4. 990678Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (1 family) (S)
  5. 990679Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (2 proteins)
  6. 990680Protein Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52735] (2 species)
  7. 990681Species Salmonella typhimurium [TaxId:90371] [52736] (28 PDB entries)
  8. 990692Domain d1l5ka_: 1l5k A: [77707]
    complexed with 1rb, nio

Details for d1l5ka_

PDB Entry: 1l5k (more details), 2 Å

PDB Description: Crystal Structure of CobT complexed with N1-(5'-phosphoribosyl)-benzimidazole and nicotinate
PDB Compounds: (A:) Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

SCOPe Domain Sequences for d1l5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5ka_ c.39.1.1 (A:) Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) {Salmonella typhimurium [TaxId: 90371]}
lhallrdipapdaeamartqqhidgllkppgslgrletlavqlagmpglngtpqvgekav
lvmcadhgvwdegvavspkivtaiqaanmtrgttgvcvlaaqagakvhvidvgidaepip
gvvnmrvargcgniavgpamsrlqaealllevsrytcdlaqrgvtlfgvgelgmanttpa
aamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvggfdl
vgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarialahl
smepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlp

SCOPe Domain Coordinates for d1l5ka_:

Click to download the PDB-style file with coordinates for d1l5ka_.
(The format of our PDB-style files is described here.)

Timeline for d1l5ka_: