Lineage for d1l4za_ (1l4z A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 465566Protein Plasmin(ogen), catalytic domain [50588] (1 species)
  7. 465567Species Human (Homo sapiens) [TaxId:9606] [50589] (7 PDB entries)
  8. 465578Domain d1l4za_: 1l4z A: [77703]
    Other proteins in same PDB: d1l4zb_
    microplasminogen

Details for d1l4za_

PDB Entry: 1l4z (more details), 2.8 Å

PDB Description: x-ray crystal structure of the complex of microplasminogen with alpha domain of streptokinase in the presence cadmium ions

SCOP Domain Sequences for d1l4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l4za_ b.47.1.2 (A:) Plasmin(ogen), catalytic domain {Human (Homo sapiens)}
psfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaah
cleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvi
paclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqst
elcaghlaggtdscqgdaggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtw
iegvmrnn

SCOP Domain Coordinates for d1l4za_:

Click to download the PDB-style file with coordinates for d1l4za_.
(The format of our PDB-style files is described here.)

Timeline for d1l4za_: