SCOP 1.75: Domain d1l4ha_: 1l4h A:

Lineage for d1l4ha_ (1l4h A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567

4. Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (1 family)

5. Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (1 protein)

6. Protein Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52735] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [52736] (28 PDB entries)

8. Domain d1l4ha_: 1l4h A: [77688]
   complexed with ind, ncn

Details for d1l4ha_

PDB Entry: 1l4h, 2.1 Å

PDB Description: crystal structure of cobt complexed with indole and nicotinate mononucleotide

PDB Compounds: (A:) Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

SCOP Domain Sequences for d1l4ha_:

Sequence; same for both SEQRES and ATOM records:

>d1l4ha_ c.39.1.1 (A:) Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) {Salmonella typhimurium [TaxId: 90371]}
lhallrdipapdaeamartqqhidgllkppgslgrletlavqlagmpglngtpqvgekav
lvmcadhgvwdegvavspkivtaiqaanmtrgttgvcvlaaqagakvhvidvgidaepip
gvvnmrvargcgniavgpamsrlqaealllevsrytcdlaqrgvtlfgvgelgmanttpa
aamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvggfdl
vgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarialahl
smepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlp

Timeline for d1l4ha_:

• d1l4ha_ first appeared in SCOP 1.63
  
• d1l4ha_ appears in SCOP 1.73
  
• d1l4ha_ appears in SCOPe 2.01
  
• d1l4ha_ appears in the current release, SCOPe 2.08