Lineage for d1l3cd_ (1l3c D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145795Family c.66.1.22: Precorrin-6Y methyltransferase (CbiT) [82472] (1 protein)
  6. 2145796Protein Precorrin-6Y methyltransferase (CbiT) [82473] (1 species)
  7. 2145797Species Methanobacterium thermoautotrophicum [TaxId:145262] [82474] (5 PDB entries)
    MTH146
  8. 2145807Domain d1l3cd_: 1l3c D: [77674]
    structural genomics

Details for d1l3cd_

PDB Entry: 1l3c (more details), 2.31 Å

PDB Description: mt0146, the precorrin-6y methyltransferase (cbit) homolog from m. thermoautotrophicum, c2 spacegroup with short cell
PDB Compounds: (D:) Precorrin-6y methyltransferase/putative decarboxylase

SCOPe Domain Sequences for d1l3cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3cd_ c.66.1.22 (D:) Precorrin-6Y methyltransferase (CbiT) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvya
idrnpeaisttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilrii
kdklkpggriivtailletkfeameclrdlgfdvnitelniargraldrgtmmvsrnpva
liytgv

SCOPe Domain Coordinates for d1l3cd_:

Click to download the PDB-style file with coordinates for d1l3cd_.
(The format of our PDB-style files is described here.)

Timeline for d1l3cd_: