Lineage for d1l3cb_ (1l3c B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247550Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 247551Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (23 families) (S)
  5. 247786Family c.66.1.22: Precorrin-6Y methyltransferase (CbiT) [82472] (1 protein)
  6. 247787Protein Precorrin-6Y methyltransferase (CbiT) [82473] (1 species)
  7. 247788Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [82474] (4 PDB entries)
    MTH146
  8. 247796Domain d1l3cb_: 1l3c B: [77672]

Details for d1l3cb_

PDB Entry: 1l3c (more details), 2.31 Å

PDB Description: mt0146, the precorrin-6y methyltransferase (cbit) homolog from m. thermoautotrophicum, c2 spacegroup with short cell

SCOP Domain Sequences for d1l3cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3cb_ c.66.1.22 (B:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum}
mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvya
idrnpeaisttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilrii
kdklkpggriivtailletkfeameclrdlgfdvnitelniargraldrgtmmvsrnpva
liytgv

SCOP Domain Coordinates for d1l3cb_:

Click to download the PDB-style file with coordinates for d1l3cb_.
(The format of our PDB-style files is described here.)

Timeline for d1l3cb_: