SCOP 1.75: Domain d1l2oc_: 1l2o C:

Lineage for d1l2oc_ (1l2o C:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Regulatory Chain [47527] (2 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (13 PDB entries)
   Uniprot P07291

8. Domain d1l2oc_: 1l2o C: [77661]
   Other proteins in same PDB: d1l2oa1, d1l2oa2, d1l2ob_
   complexed with adp, ca, mg, pdm

Details for d1l2oc_

PDB Entry: 1l2o, 2.8 Å

PDB Description: scallop myosin s1-adp-p-pdm in the actin-detached conformation

PDB Compounds: (C:) myosin essential light chain

SCOP Domain Sequences for d1l2oc_:

Sequence; same for both SEQRES and ATOM records:

>d1l2oc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
klsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgek
slpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsded
vdeiikltdlqedlegnvkyedfvkkvmagpyp

Timeline for d1l2oc_:

• d1l2oc_ first appeared in SCOP 1.63
  
• d1l2oc_ appears in SCOP 1.73
  
• d1l2oc_ appears in SCOPe 2.01
  
• d1l2oc_ appears in the current release, SCOPe 2.08