Class b: All beta proteins [48724] (119 folds) |
Fold b.34: SH3-like barrel [50036] (12 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) |
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
Protein Myosin S1 fragment, N-terminal domain [50086] (3 species) |
Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (8 PDB entries) |
Domain d1l2oa1: 1l2o A:29-76 [77658] Other proteins in same PDB: d1l2oa2, d1l2ob_, d1l2oc_ complexed with adp, ca, mg, pdm |
PDB Entry: 1l2o (more details), 2.8 Å
SCOP Domain Sequences for d1l2oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l2oa1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians)} dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs
Timeline for d1l2oa1: