SCOP 1.63: Domain d1l2oa1: 1l2o A:29-76

Lineage for d1l2oa1 (1l2o A:29-76)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.34: SH3-like barrel [50036] (12 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (8 PDB entries)

8. Domain d1l2oa1: 1l2o A:29-76 [77658]
   Other proteins in same PDB: d1l2oa2, d1l2ob_, d1l2oc_
   complexed with adp, ca, mg, pdm

Details for d1l2oa1

PDB Entry: 1l2o, 2.8 Å

PDB Description: scallop myosin s1-adp-p-pdm in the actin-detached conformation

SCOP Domain Sequences for d1l2oa1:

Sequence; same for both SEQRES and ATOM records:

>d1l2oa1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians)}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

Timeline for d1l2oa1:

• d1l2oa1 is new in SCOP 1.63
  
• d1l2oa1 appears in SCOP 1.65
  
• d1l2oa1 appears in the current release, SCOPe 2.08