Lineage for d1l2la_ (1l2l A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137600Family c.72.1.3: ADP-specific Phosphofructokinase/Glucokinase [64147] (3 protein domains)
    Pfam PF04587
  6. 2137601Protein ADP-dependent glucokinase [64148] (2 species)
  7. 2137604Species Thermococcus litoralis [TaxId:2265] [64149] (2 PDB entries)
  8. 2137605Domain d1l2la_: 1l2l A: [77656]

Details for d1l2la_

PDB Entry: 1l2l (more details), 2 Å

PDB Description: Crystal structure of ADP-dependent glucokinase from a Pyrococcus Horikoshii
PDB Compounds: (A:) ADP-dependent glucokinase

SCOPe Domain Sequences for d1l2la_:

Sequence, based on SEQRES records: (download)

>d1l2la_ c.72.1.3 (A:) ADP-dependent glucokinase {Thermococcus litoralis [TaxId: 2265]}
weslyekaldkveasirkvrgvllayntnidaikylkredlekriekvgkeevlryseel
pkeietipqllgsilwsikrgkaaellvvsrevreymrkwgwdelrmggqvgimanllgg
vygipviahvpqlselqaslfldgpiyvptfergelrlihprefrkgeedcihyiyefpr
nfkvldfeaprenrfigaaddynpilyvreewierfeeiakrselaiisglhpltqenhg
kpiklvrehlkilndlgirahlefaftpdevvrleivkllkhfysvglnevelasvvsvm
gekelaeriiskdpadpiaviegllkliketgvkrihfhtygyylaltrekgehvrdall
fsalaaatkamkgnieklsdireglavpigeqglevekilekefslrdgigsiedyqltf
iptkvvkkpkstvgigdtisssafvsefslh

Sequence, based on observed residues (ATOM records): (download)

>d1l2la_ c.72.1.3 (A:) ADP-dependent glucokinase {Thermococcus litoralis [TaxId: 2265]}
weslyekaldkveasirkvrgvllayntnidaikylkredlekriekvgkeevlryseel
pkeietipqllgsilwsikrgkaaellvvsrevreymrkwgwdelrmggqvgimanllgg
vygipviahvpqlselqaslfldgpiyvptrlihprefedcihyiyefprnfkvldfeap
renrfigaaddynpilyvreewierfeeiakrselaiisglhpltqenhgkpiklvrehl
kilndlgirahlefaftpdevvrleivkllkhfysvglnevelasvvsvmgekelaerii
skdpadpiaviegllkliketgvkrihfhtygyylaltrekgehvrdallfsalaaatka
mkgnieklsdireglavpigeqglevekilekefslrdgigsiedyqltfiptkgigdti
sssafvsefslh

SCOPe Domain Coordinates for d1l2la_:

Click to download the PDB-style file with coordinates for d1l2la_.
(The format of our PDB-style files is described here.)

Timeline for d1l2la_: