Lineage for d1l2ha_ (1l2h A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1790652Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1790961Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 1790989Protein Interleukin-1beta [50363] (2 species)
  7. 1790990Species Human (Homo sapiens) [TaxId:9606] [50364] (25 PDB entries)
    Uniprot P01584 117-269
  8. 1790991Domain d1l2ha_: 1l2h A: [77655]
    mutant

Details for d1l2ha_

PDB Entry: 1l2h (more details), 1.54 Å

PDB Description: crystal structure of interleukin 1-beta f42w/w120f mutant
PDB Compounds: (A:) Interleukin 1-beta

SCOPe Domain Sequences for d1l2ha_:

Sequence, based on SEQRES records: (download)

>d1l2ha_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
rslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvwsmsfvqgeesndkipvalglk
eknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnfyis
tsqaenmpvflggtkggqditdftmqfvs

Sequence, based on observed residues (ATOM records): (download)

>d1l2ha_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
rslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvwsmsfvqgeesnkipvalglke
knlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnfyist
sqaenmpvflggqditdftmqfvs

SCOPe Domain Coordinates for d1l2ha_:

Click to download the PDB-style file with coordinates for d1l2ha_.
(The format of our PDB-style files is described here.)

Timeline for d1l2ha_: