SCOP 1.63: Domain d1l0qc2: 1l0q C:1-301

Lineage for d1l0qc2 (1l0q C:1-301)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (10 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (3 families)

5. Family b.69.2.3: YVTN repeat [82166] (1 protein)
   more regular propeller with clear sequence repeats
   this is a repeat family; one repeat unit is 1l0q D:76-118 found in domain

6. Protein Surface layer protein [82167] (1 species)

7. Species Archaeon Methanosarcina mazei [TaxId:2209] [82168] (1 PDB entry)

8. Domain d1l0qc2: 1l0q C:1-301 [77649]
   Other proteins in same PDB: d1l0qa1, d1l0qb1, d1l0qc1, d1l0qd1

Details for d1l0qc2

PDB Entry: 1l0q, 2.4 Å

PDB Description: Tandem YVTN beta-propeller and PKD domains from an archaeal surface layer protein

SCOP Domain Sequences for d1l0qc2:

Sequence; same for both SEQRES and ATOM records:

>d1l0qc2 b.69.2.3 (C:1-301) Surface layer protein {Archaeon Methanosarcina mazei}
stfayiansesdnisvidvtsnkvtatipvgsnpmgavispdgtkvyvanahsndvsiid
tatnnviatvpagsspqgvavspdgkqvyvtnmasstlsvidttsntvagtvktgksplg
lalspdgkklyvtnngdktvsvintvtkavintvsvgrspkgiavtpdgtkvyvanfdsm
sisvidtvtnsvidtvkveaapsgiavnpegtkayvtnvdkyfntvsmidtgtnkitari
pvgpdpagiavtpdgkkvyvalsfcntvsvidtatntitatmavgknpyasgqfigsipv
q

Timeline for d1l0qc2:

• d1l0qc2 is new in SCOP 1.63
  
• d1l0qc2 appears in SCOP 1.65
  
• d1l0qc2 appears in the current release, SCOPe 2.08