SCOPe 2.06: Domain d1l0qc1: 1l0q C:302-391

Lineage for d1l0qc1 (1l0q C:302-391)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.3: PKD domain [49299] (1 family)
Family b.1.3.1: PKD domain [49300] (3 proteins)
Pfam PF00801
Protein Surface layer protein [81979] (1 species)
Species Methanosarcina mazei [TaxId:2209] [81980] (1 PDB entry)
Domain d1l0qc1: 1l0q C:302-391 [77648]
Other proteins in same PDB: d1l0qa2, d1l0qb2, d1l0qc2, d1l0qd2

Details for d1l0qc1

PDB Entry: 1l0q (more details), 2.4 Å

PDB Description: Tandem YVTN beta-propeller and PKD domains from an archaeal surface layer protein

PDB Compounds: (C:) Surface layer protein

SCOPe Domain Sequences for d1l0qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0qc1 b.1.3.1 (C:302-391) Surface layer protein {Methanosarcina mazei [TaxId: 2209]}
pvypsadfksnitsgyiflsepvqftdlskdatewkwdfgdgssskkqnpthtysetgiy
tvrltvsnsngtdsqistvnvvlkgsptps

SCOPe Domain Coordinates for d1l0qc1:

Click to download the PDB-style file with coordinates for d1l0qc1.
(The format of our PDB-style files is described here.)

Timeline for d1l0qc1: