Lineage for d1l0qa2 (1l0q A:1-301)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065850Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 2065879Family b.69.2.3: YVTN repeat [82166] (1 protein)
    more regular propeller with clear sequence repeats
  6. 2065880Protein Surface layer protein [82167] (1 species)
  7. 2065881Species Methanosarcina mazei [TaxId:2209] [82168] (1 PDB entry)
  8. 2065882Domain d1l0qa2: 1l0q A:1-301 [77645]
    Other proteins in same PDB: d1l0qa1, d1l0qb1, d1l0qc1, d1l0qd1

Details for d1l0qa2

PDB Entry: 1l0q (more details), 2.4 Å

PDB Description: Tandem YVTN beta-propeller and PKD domains from an archaeal surface layer protein
PDB Compounds: (A:) Surface layer protein

SCOPe Domain Sequences for d1l0qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Methanosarcina mazei [TaxId: 2209]}
stfayiansesdnisvidvtsnkvtatipvgsnpmgavispdgtkvyvanahsndvsiid
tatnnviatvpagsspqgvavspdgkqvyvtnmasstlsvidttsntvagtvktgksplg
lalspdgkklyvtnngdktvsvintvtkavintvsvgrspkgiavtpdgtkvyvanfdsm
sisvidtvtnsvidtvkveaapsgiavnpegtkayvtnvdkyfntvsmidtgtnkitari
pvgpdpagiavtpdgkkvyvalsfcntvsvidtatntitatmavgknpyasgqfigsipv
q

SCOPe Domain Coordinates for d1l0qa2:

Click to download the PDB-style file with coordinates for d1l0qa2.
(The format of our PDB-style files is described here.)

Timeline for d1l0qa2: