Lineage for d1l0ha_ (1l0h A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280342Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 280343Superfamily a.28.1: ACP-like [47336] (3 families) (S)
  5. 280344Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (4 proteins)
  6. 280349Protein Acyl carrier protein [47338] (3 species)
  7. 280355Species Escherichia coli [TaxId:562] [47339] (3 PDB entries)
  8. 280357Domain d1l0ha_: 1l0h A: [77642]
    complexed with zn

Details for d1l0ha_

PDB Entry: 1l0h (more details), 2 Å

PDB Description: crystal structure of butyryl-acp from e.coli

SCOP Domain Sequences for d1l0ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0ha_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghq

SCOP Domain Coordinates for d1l0ha_:

Click to download the PDB-style file with coordinates for d1l0ha_.
(The format of our PDB-style files is described here.)

Timeline for d1l0ha_: