Lineage for d1kzpb_ (1kzp B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216372Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 216502Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) (S)
  5. 216545Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 216546Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 216551Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (14 PDB entries)
  8. 216554Domain d1kzpb_: 1kzp B: [77641]
    Other proteins in same PDB: d1kzpa_
    complex with k-ras4b peptide product
    complexed with acy, far, zn

Details for d1kzpb_

PDB Entry: 1kzp (more details), 2.1 Å

PDB Description: protein farnesyltransferase complexed with a farnesylated k-ras4b peptide product

SCOP Domain Sequences for d1kzpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzpb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus)}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

SCOP Domain Coordinates for d1kzpb_:

Click to download the PDB-style file with coordinates for d1kzpb_.
(The format of our PDB-style files is described here.)

Timeline for d1kzpb_: