SCOP 1.71: Domain d1kzob_: 1kzo B:

Lineage for d1kzob_ (1kzo B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (26 PDB entries)

8. Domain d1kzob_: 1kzo B: [77639]
   Other proteins in same PDB: d1kzoa_
   complex with k-ras4b peptide product and farnesyl diphosphate substrate bound simultaneously
   complexed with acy, far, fpp, zn

Details for d1kzob_

PDB Entry: 1kzo, 2.2 Å

PDB Description: protein farnesyltransferase complexed with farnesylated k-ras4b peptide product and farnesyl diphosphate substrate bound simultaneously

SCOP Domain Sequences for d1kzob_:

Sequence; same for both SEQRES and ATOM records:

>d1kzob_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus)}
pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
dggfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvg
gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
aalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
gsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

Timeline for d1kzob_:

• d1kzob_ first appeared in SCOP 1.63
  
• d1kzob_ appears in SCOP 1.69
  
• d1kzob_ appears in SCOP 1.73
  
• d1kzob_ appears in the current release, SCOPe 2.08