SCOP 1.75: Domain d1kzoa_: 1kzo A:

Lineage for d1kzoa_ (1kzo A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family)

5. Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)

6. Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (29 PDB entries)
   Uniprot Q04631 55-369

8. Domain d1kzoa_: 1kzo A: [77638]
   Other proteins in same PDB: d1kzob_
   complex with k-ras4b peptide product and farnesyl diphosphate substrate bound simultaneously
   complexed with acy, far, fpp, zn

Details for d1kzoa_

PDB Entry: 1kzo, 2.2 Å

PDB Description: protein farnesyltransferase complexed with farnesylated k-ras4b peptide product and farnesyl diphosphate substrate bound simultaneously

PDB Compounds: (A:) protein farnesyltransferase alpha subunit

SCOP Domain Sequences for d1kzoa_:

Sequence; same for both SEQRES and ATOM records:

>d1kzoa_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhsresdipasv

Timeline for d1kzoa_:

• d1kzoa_ first appeared in SCOP 1.63
  
• d1kzoa_ appears in SCOP 1.73
  
• d1kzoa_ appears in SCOPe 2.01
  
• d1kzoa_ appears in the current release, SCOPe 2.08