Lineage for d1kzla2 (1kzl A:93-202)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403031Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2403227Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
    duplication: consists of two homologous domains
    automatically mapped to Pfam PF00677
  6. 2403228Protein Riboflavin synthase [63784] (2 species)
    trimerizes via the additional C-terminal helix
  7. 2403242Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82113] (1 PDB entry)
  8. 2403244Domain d1kzla2: 1kzl A:93-202 [77636]
    complexed with crm, hg

Details for d1kzla2

PDB Entry: 1kzl (more details), 2.1 Å

PDB Description: Riboflavin Synthase from S.pombe bound to Carboxyethyllumazine
PDB Compounds: (A:) riboflavin synthase

SCOPe Domain Sequences for d1kzla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzla2 b.43.4.3 (A:93-202) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
rmgghfvqghvdtvaeivekkqdgeaidftfrprdpfvlkyivykgyialdgtsltithv
ddstfsimmisytqskvimakknvgdlvnvevdqigkyteklveahiadw

SCOPe Domain Coordinates for d1kzla2:

Click to download the PDB-style file with coordinates for d1kzla2.
(The format of our PDB-style files is described here.)

Timeline for d1kzla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kzla1