SCOP 1.65: Domain d1kzla2: 1kzl A:93-202

Lineage for d1kzla2 (1kzl A:93-202)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
   duplication: consists of two homologous domains

6. Protein Riboflavin synthase [63784] (2 species)
   trimerises via the additional C-terminal helix

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82113] (1 PDB entry)

8. Domain d1kzla2: 1kzl A:93-202 [77636]
   complexed with crm, hg

Details for d1kzla2

PDB Entry: 1kzl, 2.1 Å

PDB Description: Riboflavin Synthase from S.pombe bound to Carboxyethyllumazine

SCOP Domain Sequences for d1kzla2:

Sequence; same for both SEQRES and ATOM records:

>d1kzla2 b.43.4.3 (A:93-202) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe)}
rmgghfvqghvdtvaeivekkqdgeaidftfrprdpfvlkyivykgyialdgtsltithv
ddstfsimmisytqskvimakknvgdlvnvevdqigkyteklveahiadw

Timeline for d1kzla2:

• d1kzla2 first appeared in SCOP 1.63
  
• d1kzla2 appears in SCOP 1.67
  
• d1kzla2 appears in the current release, SCOPe 2.08