![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
![]() | Family b.43.4.3: Riboflavin synthase [63783] (1 protein) duplication: consists of two homologous domains automatically mapped to Pfam PF00677 |
![]() | Protein Riboflavin synthase [63784] (2 species) trimerizes via the additional C-terminal helix |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82113] (1 PDB entry) |
![]() | Domain d1kzla2: 1kzl A:93-202 [77636] complexed with crm, hg |
PDB Entry: 1kzl (more details), 2.1 Å
SCOPe Domain Sequences for d1kzla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kzla2 b.43.4.3 (A:93-202) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} rmgghfvqghvdtvaeivekkqdgeaidftfrprdpfvlkyivykgyialdgtsltithv ddstfsimmisytqskvimakknvgdlvnvevdqigkyteklveahiadw
Timeline for d1kzla2: