Class b: All beta proteins [48724] (144 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) |
Family b.43.4.3: Riboflavin synthase [63783] (1 protein) duplication: consists of two homologous domains |
Protein Riboflavin synthase [63784] (2 species) trimerizes via the additional C-terminal helix |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82113] (1 PDB entry) |
Domain d1kzla1: 1kzl A:1-92 [77635] |
PDB Entry: 1kzl (more details), 2.1 Å
SCOP Domain Sequences for d1kzla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kzla1 b.43.4.3 (A:1-92) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe)} mftglveaigvvkdvqgtidngfamkieapqilddchtgdsiavngtcltvtdfdryhft vgiapeslrltnlgqckagdpvnleravlsst
Timeline for d1kzla1: