Lineage for d1kzla1 (1kzl A:1-92)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298343Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 298441Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 298546Family b.43.4.3: Riboflavin synthase [63783] (1 protein)
    duplication: consists of two homologous domains
  6. 298547Protein Riboflavin synthase [63784] (2 species)
    trimerises via the additional C-terminal helix
  7. 298559Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [82113] (1 PDB entry)
  8. 298560Domain d1kzla1: 1kzl A:1-92 [77635]

Details for d1kzla1

PDB Entry: 1kzl (more details), 2.1 Å

PDB Description: Riboflavin Synthase from S.pombe bound to Carboxyethyllumazine

SCOP Domain Sequences for d1kzla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzla1 b.43.4.3 (A:1-92) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe)}
mftglveaigvvkdvqgtidngfamkieapqilddchtgdsiavngtcltvtdfdryhft
vgiapeslrltnlgqckagdpvnleravlsst

SCOP Domain Coordinates for d1kzla1:

Click to download the PDB-style file with coordinates for d1kzla1.
(The format of our PDB-style files is described here.)

Timeline for d1kzla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kzla2