SCOPe 2.07: Domain d1kytb1: 1kyt B:1-224

Lineage for d1kytb1 (1kyt B:1-224)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Phosphoglycolate phosphatase, PGPase [82389] (2 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [82390] (2 PDB entries)

8. Domain d1kytb1: 1kyt B:1-224 [77632]
   Other proteins in same PDB: d1kyta2, d1kytb2
   structural genomics; MCSG target APC014
   complexed with ca

Details for d1kytb1

PDB Entry: 1kyt, 1.7 Å

PDB Description: crystal structure of thermoplasma acidophilum 0175 (apc014)

PDB Compounds: (B:) hypothetical protein TA0175

SCOPe Domain Sequences for d1kytb1:

Sequence; same for both SEQRES and ATOM records:

>d1kytb1 c.108.1.10 (B:1-224) Phosphoglycolate phosphatase, PGPase {Thermoplasma acidophilum [TaxId: 2303]}
mirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflging
pvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdidped
vdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnndmp
mfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm

Timeline for d1kytb1:

• d1kytb1 first appeared in SCOP 1.63, called d1kytb_
  
• d1kytb1 appears in SCOPe 2.06
  
• d1kytb1 appears in the current release, SCOPe 2.08