SCOP 1.63: Domain d1kytb_: 1kyt B:

Lineage for d1kytb_ (1kyt B:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (10 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (1 protein)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Hypothetical protein TA0175 [82389] (1 species)

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [82390] (2 PDB entries)

8. Domain d1kytb_: 1kyt B: [77632]
   structural genomics protein; complexed with ca, mse; mutant

Details for d1kytb_

PDB Entry: 1kyt, 1.7 Å

PDB Description: crystal structure of thermoplasma acidophilum 0175 (apc014)

SCOP Domain Sequences for d1kytb_:

Sequence; same for both SEQRES and ATOM records:

>d1kytb_ c.108.1.10 (B:) Hypothetical protein TA0175 {Archaeon Thermoplasma acidophilum}
hmirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflgin
gpvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdidpe
dvdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnndm
pmfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm

Timeline for d1kytb_:

• d1kytb_ is new in SCOP 1.63
  
• d1kytb_ appears in SCOP 1.65
  
• d1kytb_ appears in the current release, SCOPe 2.08, called d1kytb1