Lineage for d1kyta1 (1kyt A:1-224)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919946Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2919962Protein Phosphoglycolate phosphatase, PGPase [82389] (2 species)
  7. 2919966Species Thermoplasma acidophilum [TaxId:2303] [82390] (2 PDB entries)
  8. 2919969Domain d1kyta1: 1kyt A:1-224 [77631]
    Other proteins in same PDB: d1kyta2, d1kytb2
    structural genomics; MCSG target APC014
    complexed with ca

Details for d1kyta1

PDB Entry: 1kyt (more details), 1.7 Å

PDB Description: crystal structure of thermoplasma acidophilum 0175 (apc014)
PDB Compounds: (A:) hypothetical protein TA0175

SCOPe Domain Sequences for d1kyta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyta1 c.108.1.10 (A:1-224) Phosphoglycolate phosphatase, PGPase {Thermoplasma acidophilum [TaxId: 2303]}
mirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflging
pvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdidped
vdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnndmp
mfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm

SCOPe Domain Coordinates for d1kyta1:

Click to download the PDB-style file with coordinates for d1kyta1.
(The format of our PDB-style files is described here.)

Timeline for d1kyta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kyta2