Lineage for d1ky5d1 (1ky5 D:3190-3352)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308772Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 308825Protein S-adenosylhomocystein hydrolase [51845] (2 species)
  7. 308830Species Rat (Rattus norvegicus) [TaxId:10116] [51847] (6 PDB entries)
  8. 308846Domain d1ky5d1: 1ky5 D:3190-3352 [77626]
    Other proteins in same PDB: d1ky5a2, d1ky5b2, d1ky5c2, d1ky5d2
    complexed with ady, nai; mutant

Details for d1ky5d1

PDB Entry: 1ky5 (more details), 2.8 Å

PDB Description: d244e mutant s-adenosylhomocysteine hydrolase refined with noncrystallographic restraints

SCOP Domain Sequences for d1ky5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ky5d1 c.2.1.4 (D:3190-3352) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus)}
nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteiepinal
qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw
lnenavekvnikpqvdryllknghriillaegrlvnlgcamgh

SCOP Domain Coordinates for d1ky5d1:

Click to download the PDB-style file with coordinates for d1ky5d1.
(The format of our PDB-style files is described here.)

Timeline for d1ky5d1: