SCOP 1.73: Domain d1ky5c2: 1ky5 C:2002-2189,C:2353-2431

Lineage for d1ky5c2 (1ky5 C:2002-2189,C:2353-2431)

Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)
Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
Protein S-adenosylhomocystein hydrolase [52301] (3 species)
contains additional secondary structures disguising the superfamily fold
Species Rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries)
Domain d1ky5c2: 1ky5 C:2002-2189,C:2353-2431 [77625]
Other proteins in same PDB: d1ky5a1, d1ky5b1, d1ky5c1, d1ky5d1

Details for d1ky5c2

PDB Entry: 1ky5 (more details), 2.8 Å

PDB Description: d244e mutant s-adenosylhomocysteine hydrolase refined with noncrystallographic restraints

PDB Compounds: (C:) s-adenosylhomocysteine hydrolase

SCOP Domain Sequences for d1ky5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ky5c2 c.23.12.3 (C:2002-2189,C:2353-2431) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus) [TaxId: 10116]}
dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmpingpfkpdhyry

SCOP Domain Coordinates for d1ky5c2:

Click to download the PDB-style file with coordinates for d1ky5c2.
(The format of our PDB-style files is described here.)

Timeline for d1ky5c2: