Lineage for d1ky5a2 (1ky5 A:2-189,A:353-431)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1357589Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 1357699Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 1357700Protein S-adenosylhomocystein hydrolase [52301] (3 species)
    contains additional secondary structures disguising the superfamily fold
  7. 1357705Species Norway rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries)
  8. 1357718Domain d1ky5a2: 1ky5 A:2-189,A:353-431 [77621]
    Other proteins in same PDB: d1ky5a1, d1ky5b1, d1ky5c1, d1ky5d1
    complexed with ady, nai; mutant

Details for d1ky5a2

PDB Entry: 1ky5 (more details), 2.8 Å

PDB Description: d244e mutant s-adenosylhomocysteine hydrolase refined with noncrystallographic restraints
PDB Compounds: (A:) s-adenosylhomocysteine hydrolase

SCOPe Domain Sequences for d1ky5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ky5a2 c.23.12.3 (A:2-189,A:353-431) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmpingpfkpdhyry

SCOPe Domain Coordinates for d1ky5a2:

Click to download the PDB-style file with coordinates for d1ky5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ky5a2: