Lineage for d1ky4d1 (1ky4 D:3190-3352)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1348764Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
    this domain interrupts the other domain which defines family
  6. 1348865Protein S-adenosylhomocystein hydrolase [51845] (3 species)
  7. 1348870Species Norway rat (Rattus norvegicus) [TaxId:10116] [51847] (7 PDB entries)
  8. 1348894Domain d1ky4d1: 1ky4 D:3190-3352 [77618]
    Other proteins in same PDB: d1ky4a2, d1ky4b2, d1ky4c2, d1ky4d2
    complexed with nad

Details for d1ky4d1

PDB Entry: 1ky4 (more details), 2.8 Å

PDB Description: s-adenosylhomocysteine hydrolase refined with noncrystallographic restraints
PDB Compounds: (D:) s-adenosylhomocysteine hydrolase

SCOPe Domain Sequences for d1ky4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ky4d1 c.2.1.4 (D:3190-3352) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpinal
qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw
lnenavekvnikpqvdryllknghriillaegrlvnlgcamgh

SCOPe Domain Coordinates for d1ky4d1:

Click to download the PDB-style file with coordinates for d1ky4d1.
(The format of our PDB-style files is described here.)

Timeline for d1ky4d1: