SCOP 1.75: Domain d1ky4b2: 1ky4 B:1004-1189,B:1353-1431

Lineage for d1ky4b2 (1ky4 B:1004-1189,B:1353-1431)

Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)
Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
Protein S-adenosylhomocystein hydrolase [52301] (3 species)
contains additional secondary structures disguising the superfamily fold
Species Rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries)
Domain d1ky4b2: 1ky4 B:1004-1189,B:1353-1431 [77615]
Other proteins in same PDB: d1ky4a1, d1ky4b1, d1ky4c1, d1ky4d1

Details for d1ky4b2

PDB Entry: 1ky4 (more details), 2.8 Å

PDB Description: s-adenosylhomocysteine hydrolase refined with noncrystallographic restraints

PDB Compounds: (B:) s-adenosylhomocysteine hydrolase

SCOP Domain Sequences for d1ky4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ky4b2 c.23.12.3 (B:1004-1189,B:1353-1431) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus) [TaxId: 10116]}
lpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetavli
etlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkdgp
lnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvndsv
tkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkl
tkltekqaqylgmpingpfkpdhyry

SCOP Domain Coordinates for d1ky4b2:

Click to download the PDB-style file with coordinates for d1ky4b2.
(The format of our PDB-style files is described here.)

Timeline for d1ky4b2: