Lineage for d1ky4b2 (1ky4 B:1004-1189,B:1353-1431)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 311051Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 311588Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 311649Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 311650Protein S-adenosylhomocystein hydrolase [52301] (2 species)
    contains additional secondary structures disguising the superfamily fold
  7. 311655Species Rat (Rattus norvegicus) [TaxId:10116] [52303] (6 PDB entries)
  8. 311677Domain d1ky4b2: 1ky4 B:1004-1189,B:1353-1431 [77615]
    Other proteins in same PDB: d1ky4a1, d1ky4b1, d1ky4c1, d1ky4d1

Details for d1ky4b2

PDB Entry: 1ky4 (more details), 2.8 Å

PDB Description: s-adenosylhomocysteine hydrolase refined with noncrystallographic restraints

SCOP Domain Sequences for d1ky4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ky4b2 c.23.12.3 (B:1004-1189,B:1353-1431) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus)}
lpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetavli
etlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkdgp
lnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvndsv
tkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkl
tkltekqaqylgmpingpfkpdhyry

SCOP Domain Coordinates for d1ky4b2:

Click to download the PDB-style file with coordinates for d1ky4b2.
(The format of our PDB-style files is described here.)

Timeline for d1ky4b2: