SCOPe 2.08: Domain d1kx9b_: 1kx9 B:

Lineage for d1kx9b_ (1kx9 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.21: Chemosensory protein Csp2 [100910] (2 families)
   automatically mapped to Pfam PF03392

5. Family a.118.21.1: Chemosensory protein Csp2 [81898] (2 proteins)

6. Protein Chemosensory protein Csp2 [81899] (1 species)

7. Species Cabbage moth (Mamestra brassicae) [TaxId:55057] [81900] (5 PDB entries)

8. Domain d1kx9b_: 1kx9 B: [77603]
   complexed with act

Details for d1kx9b_

PDB Entry: 1kx9, 1.65 Å

PDB Description: antennal chemosensory protein a6 from the moth mamestra brassicae

PDB Compounds: (B:) chemosensory protein a6

SCOPe Domain Sequences for d1kx9b_:

Sequence; same for both SEQRES and ATOM records:

>d1kx9b_ a.118.21.1 (B:) Chemosensory protein Csp2 {Cabbage moth (Mamestra brassicae) [TaxId: 55057]}
inldeilankrllvayvncvmergkcspegkelkehlqdaiengckkctenqekgayrvi
ehlikneieiwreltakydptgnwrkkyedrakaagivipee

Timeline for d1kx9b_:

• d1kx9b_ first appeared in SCOP 1.63
  
• d1kx9b_ appears in SCOPe 2.07